NOP5/NOP58 polyclonal antibody

Other Designations ：-

Gene Description ：nucleolar protein NOP5/NOP58

Gene Alias ：HSPC120

Gene Name ：NOP5/NOP58

Note ：This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage Instruction ：Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

Storage Buffer ：In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)

Recommend Usage ：Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.

Isotype ：IgG

Purification ：Antigen affinity purification

Form ：Liquid

Reactivity ：Human

Host ：Rabbit

Sequence ：LDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIAHAGSLL

Immunogen ：Recombinant protein corresponding to amino acids of human NOP5/NOP58.

Product Description ：Rabbit polyclonal antibody raised against recombinant NOP5/NOP58.

规格 ：100 uL