OLFML2A polyclonal antibody

Other Designations ：OTTHUMP00000022113,OTTHUMP00000022114,OTTHUMP00000022115,photomedin-1

Gene Description ：olfactomedin-like 2A

Gene Alias ：FLJ00237,PRO34319

Gene Name ：OLFML2A

Note ：This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage Instruction ：Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

Storage Buffer ：In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)

Recommend Usage ：Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user.

Isotype ：IgG

Purification ：Antigen affinity purification

Form ：Liquid

Reactivity ：Human

Host ：Rabbit

Sequence ：FYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQSMVDLLEGTLYSMDLMKVHAYVHKVASQMNTLEESIKANLSREN

Immunogen ：Recombinant protein corresponding to amino acids of human OLFML2A.

Product Description ：Rabbit polyclonal antibody raised against recombinant OLFML2A.

规格 ：100 uL