TSPYL2 polyclonal antibody

Other Designations ：OTTHUMP00000023335,cell division autoantigen 1,cutaneous T-cell lymphoma-associated tumor antigen se20-4,differentially expressed nucleolar TGF-beta1 target protein

Gene Summary ：This gene encodes a member of the testis-specific protein Y-encoded, TSPY-like/SET/nucleosome assembly protein-1 superfamily. The encoded protein is localized to the nucleolus where it functions in chromatin remodeling and as an inhibitor of cell-cycle progression. This protein may play a role in the suppression of tumor growth. [provided by RefSeq

Gene Description ：TSPY-like 2

Gene Alias ：CDA1,CINAP,CTCL,DENTT,HRIHFB2216,SE20-4

Gene Name ：TSPYL2

Note ：This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage Instruction ：Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

Storage Buffer ：In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)

Recommend Usage ：Immunohistochemistry (1:1000-1:2500) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.

Isotype ：IgG

Purification ：Antigen affinity purification

Form ：Liquid

Reactivity ：Human

Host ：Rabbit

Sequence ：NPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDD

Immunogen ：Recombinant protein corresponding to amino acids of human TSPYL2.

Product Description ：Rabbit polyclonal antibody raised against recombinant TSPYL2.

规格 ：100 uL